PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF012200020CFD_t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 254aa    MW: 28075.5 Da    PI: 6.8901
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF012200020CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.91.3e-19101147148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg+WT+eEdell ++v ++G + W+tI ++++ gR +kqc++rw ++l
  TRAES3BF012200020CFD_t1 101 RGPWTEEEDELLRRLVDEHGEHKWATICKHLP-GRIGKQCRERWTNHL 147
                              89******************************.************996 PP

2Myb_DNA-binding21.55.5e-07157181429
                              S-HHHHHHHHHHHHHTTTT-HHHHHH CS
          Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIar 29 
                              WT+ +d ll+da+k +G++ W tIa+
  TRAES3BF012200020CFD_t1 157 WTEVDDILLIDAHKIHGNH-WLTIAS 181
                              *******************.****95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.69196151IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2497149IPR009057Homeodomain-like
SuperFamilySSF466895.99E-2599182IPR009057Homeodomain-like
SMARTSM007178.9E-19100149IPR001005SANT/Myb domain
PfamPF002491.4E-18101147IPR001005SANT/Myb domain
CDDcd001675.13E-18103147No hitNo description
Gene3DG3DSA:1.10.10.602.1E-7150181IPR009057Homeodomain-like
SMARTSM0071727153208IPR001005SANT/Myb domain
CDDcd001670.00121157181No hitNo description
PROSITE profilePS500904.972157189IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MASLGDMLLN QELAAEEYGR FERYTPSSAH GFSQFQQADS APTGVPDTGS LVSGFGMPPS  60
TFIVPEGTHA AAGYGAEAVP VEIPVVQRQR SASRNPQALH RGPWTEEEDE LLRRLVDEHG  120
EHKWATICKH LPGRIGKQCR ERWTNHLRPG IKKDHIWTEV DDILLIDAHK IHGNHWLTIA  180
SAGRLQPTRD GHVHPPSQRG CWIIVPGRDD EPELAVAGPQ RLRRRDAGAI LLSAPQQQQQ  240
HGAPWTRAGI SADV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-24991995106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006645039.23e-47PREDICTED: protein rough sheath 2-like
TrEMBLA0A0C4B2270.0A0A0C4B227_WHEAT; Uncharacterized protein
STRINGMLOC_14401.12e-96(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.24e-22myb domain protein 3r-4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]